|
[KallR]Ubiquitin (human), (recombinant) (untagged)
Product Specification
Sequence: H-MQIFVRTLTGRTITLEVEPSDTIENVRARIQDREGIPPDQQ RLIFAGRQLEDGRTLSDYNIQRESTLHLVLRLRGG-OH
MW: ~8.7 kDa
Source: Produced in E. coli.
UniProt ID: P62988
Formulation: Lyophilized.
Purity: ≥95% (SDS-PAGE) (Coomassie staining)
Purity Detail: Purified by perchloric acid treatment of a soluble lysate, followed by gradient elution from a cation exchange column.
Appearance: White solid.
Reconstitution: Reconstitute with aqueous buffers or DMSO.
Short Term Storage: -20°C
Long Term Storage: -20°C
Use/Stability: Store solid at –20°C for up to twelve months. Store solutions at –20°C for up to three months. |